SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016825 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016825
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.15e-23
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016825   Gene: ENSCPOG00000025602   Transcript: ENSCPOT00000028259
Sequence length 109
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:3046617:3058094:-1 gene:ENSCPOG00000025602 transcript:ENSCPOT00000028259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIFKAMVGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYRRNGIGTNLVKKAIYAMVEG
DCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKLWLR
Download sequence
Identical sequences ENSCPOP00000016825 10141.ENSCPOP00000016825 ENSCPOP00000016825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]