SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016852 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016852
Domain Number 1 Region: 161-233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-18
Family Complement control module/SCR domain 0.00028
Further Details:      
 
Domain Number 2 Region: 222-290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.89e-16
Family Complement control module/SCR domain 0.00018
Further Details:      
 
Domain Number 3 Region: 95-165
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 4 Region: 33-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000836
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016852   Gene: ENSCPOG00000004694   Transcript: ENSCPOT00000025595
Sequence length 473
Comment pep:known scaffold:cavPor3:scaffold_12:15597571:15622510:-1 gene:ENSCPOG00000004694 transcript:ENSCPOT00000025595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGRPAALRCLLLLRAPALLLLLRAAAVQGDCGPLPVVPRAHPASASAGSTSFPENTTV
LYTCDQGFVKIPGKPDAVVCISSRWTDIEEFCNRNCEVPPRLPYAILKSAYISKNYFPVD
TVVEYECRPGYRKKYPIQSGKITCRDDLTWSTPAEFCEKKQCPNPGELVNGNINVTTDLL
LGSQIFFSCDPGYRLTGEASAFCMIKGNAVGWSSSLPTCIKIICPEPPQIENGRIVNEED
TYEYRHVVTYECNKGFVLTGKSHISCIVRDDVGEWSDPPPTCRVKSPPVIPPQKPTTTSA
PGTTTTLPTQKPTTVNTAGPEVPTTQRSTTVNVPGTKVPTTQRSTTVNVPGTEVPTTWKS
TTVNVPAAGNRPDTRTTIKSTTASEEKDLASGYRTFLYGVGVGVPVIVCSLGLGVYWWIH
RTSGTHVYKVDSFACGASNHWLADIAKEDLRRDFSNAQNISSLLQVLGAAQTQ
Download sequence
Identical sequences ENSCPOP00000016852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]