SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016901 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016901
Domain Number 1 Region: 3-56
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.68e-16
Family Ovomucoid domain III-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016901   Gene: ENSCPOG00000027129   Transcript: ENSCPOT00000023595
Sequence length 56
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:10369908:10371306:1 gene:ENSCPOG00000027129 transcript:ENSCPOT00000023595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGKIQLLHEGQC
Download sequence
Identical sequences ENSCPOP00000016901 ENSCPOP00000016901 10141.ENSCPOP00000016901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]