SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016989 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000016989
Domain Number - Region: 15-53
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0228
Family CUT domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016989   Gene: ENSCPOG00000022028   Transcript: ENSCPOT00000020516
Sequence length 200
Comment pep:known_by_projection scaffold:cavPor3:scaffold_68:3385540:3405347:-1 gene:ENSCPOG00000022028 transcript:ENSCPOT00000020516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGTSYSHAGGHQQLFPCEICGRHFAEDVLKRHEPICRKLFDKKRKPFNSLKQRLQGTDI
PTVKKAPQSQSQPVRKSNWRQQHEDFINAIRSAKQCMLAMKEGRPLPPPPPASVNPDYIQ
CPYCMRRFNETAAGRHINFCKDQSSRRVFDPAQTAAKLASRAQDKAQVSPKKQPTVTSAV
GALLQNRAMGAKNEALGKSG
Download sequence
Identical sequences ENSCPOP00000016989 ENSCPOP00000016989 10141.ENSCPOP00000016989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]