SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016995 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016995
Domain Number 1 Region: 63-182,258-362
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 5.23e-61
Family FabD-like 0.0000913
Further Details:      
 
Domain Number 2 Region: 190-265
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000589
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016995   Gene: ENSCPOG00000026399   Transcript: ENSCPOT00000027867
Sequence length 387
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:26965588:26968952:-1 gene:ENSCPOG00000026399 transcript:ENSCPOT00000027867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARVTRVAWARSWGPRCCRGASSFSVPPPGTVDVAELLRDATAAEERPSAAPARRTPGQ
CSVLLFPGQGSQVVGMGRGLLRFPRVRELYAAAHRVLGYDLLELSLQGPQEDLDRTVHCQ
PAVFVASLAAVEKLHHLQPAAIENCVAAAGFSVGEFAALVFAGAMEFSEGLYAVKVRAEA
MQEASEAVPSGMLSVLGQPQSKFTAACVDAQEHCRSLGIEDPVCEVSNYLFPHCRVISGH
LEALRFLRQNSSRYHFRRTKMLPVSGGFHTRLMQPAVEPLAQALKTIDIKQPLVSVHANV
SGHRYANPQHIRKLLGQQLVSPVRWEQTMHTIYTRRRGAAFPRTWEVGPGQQLGSILRSC
NLQAWKAYDHVDVLQASEDPSPEESLR
Download sequence
Identical sequences H0W205
ENSCPOP00000016995 XP_003470449.1.53824 10141.ENSCPOP00000016995 ENSCPOP00000016995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]