SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017027 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017027
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000008
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 2 Region: 154-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000139
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 36-99
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000107
Family Complement control module/SCR domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017027   Gene: ENSCPOG00000001306   Transcript: ENSCPOT00000026355
Sequence length 236
Comment pep:known scaffold:cavPor3:scaffold_12:15357666:15365116:-1 gene:ENSCPOG00000001306 transcript:ENSCPOT00000026355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLHGESRAASWWRILGACLLAAVFLLAASSDACVLPPPFEAMEPINPKPYYEIGEKV
EYRCKKGYLRQPFYLMVATCEKNHSWVPITDDGCIKKQCTYLNPPPKGRVEYINGTRTWG
DIVHFSCVEGFYVSGIAALSCELRGDNVDWNGRVPTCEKVLCSPPPKIQNGKYTFSDVQV
FEYFEAVTYSCDAVQGPDKLSLVGNEVLYCAGHQKWSSAAPECKGNNLLMYLLLHF
Download sequence
Identical sequences ENSCPOP00000017027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]