SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017122 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017122
Domain Number 1 Region: 16-111
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.41e-17
Family N-acetyl transferase, NAT 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017122   Gene: ENSCPOG00000022942   Transcript: ENSCPOT00000022755
Sequence length 111
Comment pep:known_by_projection scaffold:cavPor3:scaffold_59:6483043:6485012:1 gene:ENSCPOG00000022942 transcript:ENSCPOT00000022755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPQREEKQKTKMAKFVIRPATAADCSDILRLIKVTGGPRPMLPLPLLADLLEDGFGEHP
FYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYR
Download sequence
Identical sequences ENSCPOP00000017122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]