SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017193 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017193
Domain Number 1 Region: 957-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-104
Family Thrombospondin C-terminal domain 0.00000000547
Further Details:      
 
Domain Number 2 Region: 25-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-37
Family Laminin G-like module 0.00000892
Further Details:      
 
Domain Number 3 Region: 834-956
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.16e-35
Family TSP type-3 repeat 0.000000541
Further Details:      
 
Domain Number 4 Region: 765-836
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.36e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.81e-17
Family TSP-1 type 1 repeat 0.00011
Further Details:      
 
Domain Number 6 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000144
Family TSP-1 type 1 repeat 0.000096
Further Details:      
 
Domain Number 7 Region: 693-777
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000235
Family TSP type-3 repeat 0.00012
Further Details:      
 
Domain Number 8 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000157
Family VWC domain 0.0051
Further Details:      
 
Domain Number 9 Region: 382-425
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 10 Region: 549-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017193   Gene: ENSCPOG00000027034   Transcript: ENSCPOT00000023164
Sequence length 1172
Comment pep:known_by_projection scaffold:cavPor3:scaffold_58:2455051:2478436:1 gene:ENSCPOG00000027034 transcript:ENSCPOT00000023164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWGLSLWALCAWAGAFAGEQDEDTVFDLFSISNINRKTIGAKQFRGPDPGGPAYRFVRF
DYIPPVNAAELDRIIGAMRRKDGFFLTAQLKQDRRSRGTLLALEGPGASQRQFEIVSNGP
ADTLDLTYWVEDTEHVVSLEDVGLADSQWKNITVQVASETYSLYVGCDLMDSFSLDEPFY
EQLEAERSRMYVAKGASRESHFRGLLQNVHLVFENSVEDVLRRKGCQQGQGAEVNAISEH
TETLHLSPHITTELVGHGVDQRPEVCEHSCEELANMMRELSGLHVLVRQLDDNLRKVSSD
NQFLWELIGGPPKTKNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQISCPPVTC
AHPSFAEGQCCPTCSHEVDSEEGWSPWSEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRTCSLGKCDPRIRQNGGWSHWSPWSSCSVTCGIGNITRIRLCNSPVPQMGGKNCKGSG
RETKTCEGPPCPIDGRWSPWSPWSTCTVTCGGGIRERTRACNNPEPQHGGKDCVGDVKEY
HMCNRRSCPIDGCLSNPCFPGAACNSFPDGSWSCGSCPVGFVGNGTHCEDLDECAVVADI
CFSTNKASRCINTQPGFHCLPCPPRYKGTQPFAVGLEAAKTEKQVCEPENPCKDKTHNCH
RHAECIYLGHFSDPMYKCECQIGYAGDGLICGEDSDLDGWPNSNLVCATNATYHCIKDNC
PQLPNSGQEDFDKDGVGDACDEDDDNDGVRDEKDNCQLLFNPRQSDYDKDEVGDRCDNCP
YVHNPAQIDTDSNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQTDLDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDNDGKGDACDPDD
DNDGIPDDRDNCRLVSNPDQEDSDGDGRGDICKEDFDNDNVPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPSRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGYMRVLVYEGKQVMADSGPI
YDQTYSGGRLGLFVFSQEMVYFSDLKYECRGE
Download sequence
Identical sequences 10141.ENSCPOP00000017193 ENSCPOP00000017193 ENSCPOP00000017193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]