SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017196 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017196
Domain Number 1 Region: 2-44
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000804
Family Ovomucoid domain III-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017196   Gene: ENSCPOG00000021753   Transcript: ENSCPOT00000024898
Sequence length 46
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:10194205:10194342:1 gene:ENSCPOG00000021753 transcript:ENSCPOT00000024898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKCPYKTVNLSWLRGTIDPCPWTKQPICGTNSVTYDNPCILCIESL
Download sequence
Identical sequences ENSCPOP00000017196 10141.ENSCPOP00000017196 ENSCPOP00000017196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]