SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017212 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017212
Domain Number 1 Region: 530-745
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-105
Family Thrombospondin C-terminal domain 0.000000089
Further Details:      
 
Domain Number 2 Region: 407-528
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.01e-33
Family TSP type-3 repeat 0.00000377
Further Details:      
 
Domain Number 3 Region: 327-409
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.23e-16
Family TSP type-3 repeat 0.0000568
Further Details:      
 
Domain Number 4 Region: 30-74
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 3.4e-16
Family Assembly domain of cartilage oligomeric matrix protein 0.00016
Further Details:      
 
Domain Number 5 Region: 269-350
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000157
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 6 Region: 175-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000473
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 121-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000136
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000017212
Domain Number - Region: 229-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00187
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 90-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0271
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017212   Gene: ENSCPOG00000025029   Transcript: ENSCPOT00000021825
Sequence length 758
Comment pep:known_by_projection scaffold:cavPor3:scaffold_72:8246817:8252843:-1 gene:ENSCPOG00000025029 transcript:ENSCPOT00000021825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAMAHTAACVLLLTLGFLGTAGQGQVLLGGDLGPQMLRELQDTNAALREVRELLRQQVKE
ITFLKNTVMECDACAGMQPARTPGLTVRPLSLCAPGSCFPGVVCTETASGAGWGPCPEGF
TGNGSHCTDVNECNAHPCFPRVRCVNTSPGFRCEPCPPGFNGPTHEGVGLAFAKANKQVC
TDIDECETGQHNCVPNSLCINTRGSFQCGPCQPGFVGDQVSGCQRRAQRLCPGTPSPCHE
KAHCVLERDGSRACVCAVGWAGNGLLCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSG
QEDVDRDGIGDACDPDADGDGVPNEEDNCPLVRNPDQRNTDNDKWGDACDNCRSQKNDDQ
KDTDRDGRGDACDDDIDGDRIRNEVDNCPRVPNSDQKDSDGDGIGDACDNCPQKDNPDQR
DVDHDFVGDACDSDQDKDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPD
SRDNCRLVPNRDQGDADRDGVGDKCQGDFDADKVVDQIDVCPENAEVTLTDFRAFQTVVL
DPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGF
IFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGD
TASQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRG
GRLGVFCFSQENIIWANLRYRCNDTIPEDYETQRLQLA
Download sequence
Identical sequences 10141.ENSCPOP00000017212 ENSCPOP00000017212 ENSCPOP00000017212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]