SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017235 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017235
Domain Number 1 Region: 63-135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.28e-18
Family Complement control module/SCR domain 0.00017
Further Details:      
 
Domain Number 2 Region: 124-191
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.000046
Further Details:      
 
Domain Number 3 Region: 377-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.0000437
Further Details:      
 
Domain Number 4 Region: 515-579
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-16
Family Complement control module/SCR domain 0.00071
Further Details:      
 
Domain Number 5 Region: 578-647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.44e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 255-320
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.56e-16
Family Complement control module/SCR domain 0.00058
Further Details:      
 
Domain Number 7 Region: 320-388
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.00049
Further Details:      
 
Domain Number 8 Region: 198-261
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000027
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 449-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 10 Region: 2-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000485
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017235   Gene: ENSCPOG00000022679   Transcript: ENSCPOT00000019813
Sequence length 664
Comment pep:novel scaffold:cavPor3:scaffold_12:15392422:15432833:-1 gene:ENSCPOG00000022679 transcript:ENSCPOT00000019813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQCKAPEHFSFAMPTNPIDQSEFPVGTSLKYECRPGYYRRRFSITCQNTLVWTSAENFCK
RKSCQTPSDPVNGIVTIASDTNFGSRISYSCNRGHRLVGSPSAVCMLSGNNVAWDSEPPL
CEIIPCKPPPAIANGDFFSINREYFVYGMVVTYRCNPGKRGKTFELVGEPEIFCTSNDNE
VGIWSGPAPQCIIPNTCTPPHVDNAIMVSENKSLFSLHEIVEFRCQPGFIMSGPTTVQCQ
AQNKWGPGLPNCSTVCQPPPKISHGQHSQSNEDFSPGQEVTYSCEPGYDLLGAASLRCTP
QGDWSPAAPSCEVKVCDVFPDQLPNGHVLSPPNLQPGAKVSFHCDTGYRLIGKSSAECVI
SGNSVTWDTEPPTCEQITCEPPPTIANGDFSSTNRDKFVYGMVVTYHCHVGARGTKIFEL
VGEPSISCTSKDSQVGVWSGPAPRCTVTSMCTPPHVDNALMVSENRSVFSLHEIVELRCQ
PGFVMSGPSTVQCQATNKWGPKLPSCSLGNIPQKCQPPPKILHGQHTSSNEAFSPGQEVT
YSCEPGYDLRGTTSLRCTPQGDWSPAAPSCVVILCDIFPDFLPNGQVVFPPNLQLGAKVS
FTCNKGFLLRGSSTSHCVLDNMKAHWNSSVPVCEQIFCPHPPVIFNGTYTGTSLGNIPYG
EEVS
Download sequence
Identical sequences 10141.ENSCPOP00000017235 ENSCPOP00000017235 ENSCPOP00000017235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]