SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017263 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017263
Domain Number 1 Region: 494-830
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.47e-113
Family PDEase 0.000000296
Further Details:      
 
Domain Number 2 Region: 53-248
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-38
Family GAF domain 0.00025
Further Details:      
 
Domain Number 3 Region: 235-279,306-455
Classification Level Classification E-value
Superfamily GAF domain-like 4.71e-31
Family GAF domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017263   Gene: ENSCPOG00000022569   Transcript: ENSCPOT00000025080
Sequence length 854
Comment pep:known_by_projection scaffold:cavPor3:scaffold_73:5402685:5442097:-1 gene:ENSCPOG00000022569 transcript:ENSCPOT00000025080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQARGFLDGNPDFTHQYFEKKLSPENVSVACGNRHPVDCSSLRELCQVEESMVLF
ELVQDMQESVNMERVVFKILRHLCTLLHADRCSLFMYRQRNGVAELATRLFSVQLGSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVQDVTECPHFSSFADELTDYVTRNILAMPI
MNGKDVIAVIMAVNKLDGPSFTSEDEDVFTKYLNFATLNLKIHHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVALLDMTKEKEFFDVWPVLMGEAQPY
SGPRTPDGREIVFYKVIDYILHGKEDIKVIPTPPADHWALASGLPTYVAESGFICNIMNT
STDEMFKFQEGPLDDSGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMES
LTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVRCDKDEIQAILPTRERLGKEPADC
EEEELGKILKEELPGPTKFDIYEFHFSDLECTEMDLVKCGIQMYYELGVVRKFQIPQEVL
VRFLYSVSKAYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLAEESLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRTMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEEKVKVLEEKKKDEDRAAKKVGMEVC
NGDPAPKSSTCCIL
Download sequence
Identical sequences H0W2R8
10141.ENSCPOP00000017263 XP_003465100.1.53824 ENSCPOP00000017263 ENSCPOP00000017263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]