SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017264 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017264
Domain Number 1 Region: 651-835
Classification Level Classification E-value
Superfamily vWA-like 1.13e-53
Family Integrin A (or I) domain 0.00042
Further Details:      
 
Domain Number 2 Region: 466-650
Classification Level Classification E-value
Superfamily vWA-like 1.26e-47
Family Integrin A (or I) domain 0.00056
Further Details:      
 
Domain Number 3 Region: 835-1025
Classification Level Classification E-value
Superfamily vWA-like 3.41e-46
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 4 Region: 23-207
Classification Level Classification E-value
Superfamily vWA-like 4.31e-40
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 5 Region: 252-449
Classification Level Classification E-value
Superfamily vWA-like 1.78e-38
Family Integrin A (or I) domain 0.0035
Further Details:      
 
Domain Number 6 Region: 1023-1203
Classification Level Classification E-value
Superfamily vWA-like 1.2e-28
Family Integrin A (or I) domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017264   Gene: ENSCPOG00000007514   Transcript: ENSCPOT00000028087
Sequence length 1212
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:27638821:27665651:1 gene:ENSCPOG00000007514 transcript:ENSCPOT00000028087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIQLIVFILIIWTEALVDQSPVPGPEYADVVFLVDSSDHLGTKSFPLVKTFINKVISGL
PIEASKYRVALTQYSDTLHNEFHLNTFRSRNPMLNHLKKNFRFIGGPLRIGKALQEVHKT
YFSASTNGRDKKQFPPVLVVLASAESEDDVEEASKALRKDGVKIISVGMQEASEENLKAM
ATSQFHFNLRTARDLSMFSQNMTQIIKDVTKHREAVSADEQASVRITTVLNIIMEMVQTL
VTEIALEVSMVGKTVPFTVFCQKDSLADLVFLVDVSLGTRQNLTNLQDFLDNITESLDVQ
DSCTRLGLMSYSDSTEILSLLNSSTNQSIFQQQIRKLSLGAGKSNAGAAIEQMRKNVFSE
ANGSRRAQGVPQIAVLVTHRPSDDGVREAALNLRLEGVTVFVLSTHGANSTQLEEIASYP
EGQRVSKLDSYKDLVVYSTRFLKKIKNEVWTQVSTHAEQMELDKTGCVDTKEADIYFLID
GSSSIQAKHFVEIKEFISAVIDRFSIGPNKVRVGVVQYSSKQEEEIAISHYNNAVDLKKA
VLNIQQLQGGTLTGAGLNFTLSLIKKGKEDRASDVLCFLIVLTDGQSQDSVLEPVARLKA
EKVIIHAIGIGEADKTQLLQIAGKEDRVSFGQNFDSLKNIKNDVVHSICTQKGCEDMKAD
IMFLVDSSGSIGSPNFEIMKTFMKDLLTKIEIGANQTQIGVVQFSNYNKEEFQLNKYFTT
KEISDAIDTMSLIGSTTLTGSALTFVSQYFTYPKGARPQVRKFLILITDGEAQDDVKFPA
IALRESGVIIITVGVFGANRTQLEEISGDGSLVFHVENFDLLKAIENKLIFSVCALHADC
KRIEQLDIVFVLDHSGSIDRGQQESMINLTVHLVKKADVGRNRVQFGALKYSDDPEILFY
LNTYSTRPEITENLRRRRDTGGNTYTAKALRHSSILFREEHGSRIKQNVKQILIIITDGV
SHDHNELSSTALKLREEGITILAVGVGQANQEELEIMAGDKNNTIHVDNFDKLKDIYLPL
QERMCITATAACDLPEADVIFLCDGSDVVTDSEFVAMMTFLSDLIDSFQMQPQMQIGMAQ
YGSRYQEIIELKNSLNKTQWKSKVETVAKTKGFPQIHIALKHVLHMFDPSIGGRKNAGVP
QILVVTVSRNPAGNVIDAVKALKAHGICILVLGIGNVNKEQLLPISGNSEKLITLSDFNR
LRDVDVKKRMVR
Download sequence
Identical sequences ENSCPOP00000017264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]