SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017410 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017410
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000018
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 2 Region: 164-228
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000277
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 260-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000995
Family EGF-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017410   Gene: ENSCPOG00000015522   Transcript: ENSCPOT00000026137
Sequence length 374
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:537198:768378:1 gene:ENSCPOG00000015522 transcript:ENSCPOT00000026137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGESPRQGSGWTLGEGFCWLLLLPVMLLLIARPARLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGETVTCVCQFKCNTDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVAEGSCATGMFTPPYPAVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTATTKSEDG
HYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSISMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Download sequence
Identical sequences 10141.ENSCPOP00000017410 ENSCPOP00000017410 ENSCPOP00000017410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]