SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017525 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017525
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily HRDC-like 1e-23
Family RNA polymerase II subunit RBP4 (RpoF) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017525   Gene: ENSCPOG00000003188   Transcript: ENSCPOT00000027838
Sequence length 98
Comment pep:known scaffold:cavPor3:scaffold_66:3430019:3458437:1 gene:ENSCPOG00000003188 transcript:ENSCPOT00000027838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKDANSALLSNYEVFQLLTDLKDQRRESGKMKHSAGQQNLNTITYETLKYLSKTPCRHQS
PEIVREFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLV
Download sequence
Identical sequences ENSCPOP00000017525 10141.ENSCPOP00000017525 ENSCPOP00000017525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]