SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017527 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017527
Domain Number 1 Region: 5-36
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000568
Family Ovomucoid domain III-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017527   Gene: ENSCPOG00000022709   Transcript: ENSCPOT00000021654
Sequence length 37
Comment pep:novel scaffold:cavPor3:scaffold_6:10377764:10377874:1 gene:ENSCPOG00000022709 transcript:ENSCPOT00000021654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYKKLNPEKIVCILSYDPLCGSDGETYQNECYFCVTV
Download sequence
Identical sequences ENSCPOP00000017527 ENSCPOP00000017527 10141.ENSCPOP00000017527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]