SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017555 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017555
Domain Number 1 Region: 84-175
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.54e-25
Family L-aminoacid/polyamine oxidase 0.00016
Further Details:      
 
Domain Number 2 Region: 2-103,208-245
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000125
Family FAD-linked reductases, N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017555   Gene: ENSCPOG00000025229   Transcript: ENSCPOT00000020221
Sequence length 267
Comment pep:novel scaffold:cavPor3:scaffold_133:2326108:2326933:-1 gene:ENSCPOG00000025229 transcript:ENSCPOT00000020221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFEITGGFDQFPKALNTSLKPGTIHLSPSGDSGEVLYHERGPTLELRNLTAYYITISSSA
KATRLIAFQPPLSPDKRDALCSVHYTSATKVILACNQRFWDRDGIEGGVSITDWPSRYIH
YLSHSYPGKGVLLASYTIGEDSLFFTAVKQDQVVNTVLDDLAAVHQVPKEELAHAPHFSG
QALVLGPLHFCAFAQFTPYQFVDCSQQLFQAEGCIHFADEHTCLPHGWLDTAIKSGLRAA
RNIQAAVDKEATGGQMPLQKPFSNSQH
Download sequence
Identical sequences ENSCPOP00000017555 ENSCPOP00000017555 10141.ENSCPOP00000017555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]