SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017576 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017576
Domain Number 1 Region: 120-184
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000687
Family Extracellular domain of cell surface receptors 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000017576
Domain Number - Region: 26-113
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000183
Family Snake venom toxins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017576   Gene: ENSCPOG00000023143   Transcript: ENSCPOT00000022196
Sequence length 222
Comment pep:novel scaffold:cavPor3:scaffold_1:23301283:23305200:-1 gene:ENSCPOG00000023143 transcript:ENSCPOT00000022196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPSILKSVFTICVAAAFLLTTVESYGCTQCSKDQCSTMPSKTCHTSQACFSRKEELKA
SGQVIRGPYQEKGCSPGVCTPLAFSATMGNKTTFSYNYQCCHSEQCNKKDVPMPVDSKVN
GVVCPACYNETGLGCDPVFLHCTGKETKCAEVVGVAVRINDINIFGLFALGCATESACNL
HLNILGNIEIRTKCKGTSSGSSPLKSVSSATLASLFLLKVLL
Download sequence
Identical sequences 10141.ENSCPOP00000017576 ENSCPOP00000017576 ENSCPOP00000017576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]