SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017825 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017825
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.51e-29
Family N-acetyl transferase, NAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017825   Gene: ENSCPOG00000019924   Transcript: ENSCPOT00000021133
Sequence length 229
Comment pep:known_by_projection scaffold:cavPor3:scaffold_5:3369252:3369938:-1 gene:ENSCPOG00000019924 transcript:ENSCPOT00000021133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIRNARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKVVGYVLAKM
EEDPNDVAHGHITSLAVKRSHRRLGLAQKLMDQASRAMVENFGARYVSLHVRKSNRAALH
LYSHTLNFQVNEVEPRYYADGEDAYAMRRDLSQMAGELRRQLELKKGGHVVLGSGENQET
HSGIFPDSEKTCQQESPAATDSGSDTKESSESTESTDVQDSSEDLDSIS
Download sequence
Identical sequences XP_003477710.1.53824 ENSCPOP00000017825 ENSCPOP00000017825 10141.ENSCPOP00000017825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]