SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017907 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017907
Domain Number 1 Region: 157-195,229-266
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000204
Family Growth factor receptor domain 0.0017
Further Details:      
 
Domain Number 3 Region: 110-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000707
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017907   Gene: ENSCPOG00000024650   Transcript: ENSCPOT00000020051
Sequence length 277
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:27408827:27472811:-1 gene:ENSCPOG00000024650 transcript:ENSCPOT00000020051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAPLRALLLGAAVLLLLLVPLSSSSSSDACGPCKPAACPPLPPRGCPLGETRDACGCC
PECARAEGEPCGGAGAGRGHCAQGMECVKSRKRRKGKAGAAAGGAGVSGVCVCKNRYPVC
GSDGTTYANGCQLRAASLRAESRGEKAITQLSKGTCEQGPSIVTPPKDIWNVSGAQVYLS
CEVIGIPTPVLIWNKVKRGSYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSK
EDDGEYECHASNSQGQASASAKITVVDALHEIPVEKG
Download sequence
Identical sequences 10141.ENSCPOP00000017907 ENSCPOP00000017907 ENSCPOP00000017907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]