SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018055 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018055
Domain Number 1 Region: 25-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.65e-25
Family Laminin G-like module 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018055
Domain Number - Region: 220-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000671
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018055   Gene: ENSCPOG00000020392   Transcript: ENSCPOT00000020684
Sequence length 252
Comment pep:novel scaffold:cavPor3:scaffold_18:34510233:34511274:-1 gene:ENSCPOG00000020392 transcript:ENSCPOT00000020684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSTTSLATNGSVTSCDLLLTLKWAAELGSGLEFPGAEGQWTRFPKWNACCESELSFELKT
RAARGLVLYFDDEGFCDFLELVLTRGGRLQLSFSIFCAEPATLLADTPLNDGAWHRVRLR
RQFRNTTLLIDRVEARWVEVQSKRRMNGLQRPLRGAAAAELRGARSSSRALGARARAFRG
WIRDLRVDAARTLPEDGAEVRLDDDEPSGGGPCEAEEGEGGVCLNGGVCSVVDDRAVCDC
SRTGFRGEDCSQ
Download sequence
Identical sequences ENSCPOP00000018055 10141.ENSCPOP00000018055 ENSCPOP00000018055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]