SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018291 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018291
Domain Number 1 Region: 6-99
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.46e-18
Family Rhodopsin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018291   Gene: ENSCPOG00000021499   Transcript: ENSCPOT00000022582
Sequence length 99
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:6023514:6023810:-1 gene:ENSCPOG00000021499 transcript:ENSCPOT00000022582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRSWEGCHVDSRVDHLFPPSLYIFVIGMGLPTNCLALWAAYRQVRQRNELGVYLMNLS
VADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYT
Download sequence
Identical sequences ENSCPOP00000018291 ENSCPOP00000018291 10141.ENSCPOP00000018291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]