SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018325 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018325
Domain Number 1 Region: 223-478
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.35e-85
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 134-234
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.064
Further Details:      
 
Domain Number 3 Region: 97-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018325   Gene: ENSCPOG00000021489   Transcript: ENSCPOT00000021002
Sequence length 481
Comment pep:novel scaffold:cavPor3:scaffold_90:2056746:2071107:1 gene:ENSCPOG00000021489 transcript:ENSCPOT00000021002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCCENHGYQPEHLYPTQPPTVPNVHPVYVPQYYLPAVPQSTPRVPTHALTPLLHRRPKSS
GTCTPKTRRLQLLLLVLGAVLVALLLTGGLLWKLLLRRGCSVTGVQCSSSGPCISASLWC
DGVEQCPNGEDEKQCFRLYGPNFILQAYSLESKSWYPVCHENWSENYVPVACTNMGYRNS
FYSTQGVVDDSGATSFMKLNRSSSSTNFYKKLTLSDACSSRSLVSLRCVECGAHPTATHN
RIVGGTAATQGQWPWQVSLHFQGVHLCGGSIITPRWILTAAHCVATIHLRNAQNWMVFAG
ILRQSLMIHKEGIPVEKVIPHPSYNSKTKNNDIALLKLQTPLAFNEIDSVKPVCLPNPGL
GLDPNQQSWISGWGATYFRGKTSEELNSASVPLIENSRCNSKLLYHNLITPEMICAGFLQ
GRVDACQGDSGGPLVTDKNGIWWLIGDTSWGYGCADTFRPGVYANVTVFMDWLSRQMRVT
L
Download sequence
Identical sequences ENSCPOP00000018325 10141.ENSCPOP00000018325 ENSCPOP00000018325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]