SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018419 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018419
Domain Number 1 Region: 159-272
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-36
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 37-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 314-435
Classification Level Classification E-value
Superfamily TIMP-like 2.67e-32
Family Netrin-like domain (NTR/C345C module) 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018419   Gene: ENSCPOG00000025385   Transcript: ENSCPOT00000020902
Sequence length 446
Comment pep:known_by_projection scaffold:cavPor3:scaffold_30:3363873:3368645:-1 gene:ENSCPOG00000025385 transcript:ENSCPOT00000020902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAVPASLLVPLLTAWALLPLAQGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPN
KECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGKRLGRFCGTFRPAPL
VAPGNQVTLKMTADEGTGGRGFLLWYSGRATLGNEHQFCGGRLEKAQGSLTTPNWPESDY
PPGINCNWHIIAPPNQVILLTFGKFDLEPDTYCRYDSVSVFNGALSDDSKRLGKFCGDTA
PGPISSEGNELLVQFVSDLSVTADGFSASYKMLPRDSADKRPASSPEGGVHPGPPTLSPS
SKPQPPSLLDAPTITCPKQYRRTGTLQSNFCASDLVVTATVKSMVQGPGDALTVTVNLIG
VYKNGGLDLPSPPTGTSLKFYVPCKQYPPMKKGISYLMMGQMDEKRGPTLPPDSFVVVYR
PNQDQVLTNLSNRKCLSQPVRAVESQ
Download sequence
Identical sequences 10141.ENSCPOP00000018419 ENSCPOP00000018419 ENSCPOP00000018419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]