SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018423 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018423
Domain Number 1 Region: 59-133
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.57e-21
Family Ribosomal protein S18 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018423   Gene: ENSCPOG00000022949   Transcript: ENSCPOT00000019445
Sequence length 196
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:31001734:31015343:1 gene:ENSCPOG00000022949 transcript:ENSCPOT00000019445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTALVSGCGQLFRGLLGRPAAISWARLPARGFREVVETQEGKTTIIEGRIVPTPKES
PNPPNPSGQCPICRWNLKHKYSYEDVLLLSQFLRPHGGMLPRSVTGLCLEEHRKVEECVK
MAHRAGLLPNHRPRLPEGFVPKSKPKLNRYLTRWAPRSVKPIYKKGHRWNKVRMAVGSPL
LKDNICYSGGRWTLYH
Download sequence
Identical sequences H0W619
XP_003473885.1.53824 ENSCPOP00000018423 ENSCPOP00000018423 10141.ENSCPOP00000018423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]