SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018438 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018438
Domain Number 1 Region: 15-81
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000256
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018438
Domain Number - Region: 71-105
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000297
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018438   Gene: ENSCPOG00000004303   Transcript: ENSCPOT00000021852
Sequence length 106
Comment pep:known scaffold:cavPor3:scaffold_12:15811204:15862917:-1 gene:ENSCPOG00000004303 transcript:ENSCPOT00000021852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVTSLLATVLGRCGPPPVLFFATPAKELNQTEFTTNTVLKYTCRPGYIRIHSDQTLTC
KVNGQWRYEVFCSKKQCRNPGDLPHGTIEVKTDLFLGSKIEFSCSE
Download sequence
Identical sequences ENSCPOP00000018438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]