SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018508 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018508
Domain Number 1 Region: 95-218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.39e-16
Family N-acetyl transferase, NAT 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018508   Gene: ENSCPOG00000021848   Transcript: ENSCPOT00000026265
Sequence length 314
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:25315810:25316754:-1 gene:ENSCPOG00000021848 transcript:ENSCPOT00000026265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELILSTSLAMLTLDLACQPEVALGFNLITLTLDPTHQPELILSPRLAEPTLDSTCHPEM
TFSPGPAEITLDPNHQSEETPAPSLAELTLEPVHCRPELMDACADLINDQWPRSRASRLH
SLGQSSDAFPLCLLLLSPHPTSEAAPMVVGHARLSRVLDRPQSLLVETVVVARALRGRGF
GRRLMEGLEDFARARGFRHLHLTTHDQLYFYAHLGYRLGEPVQGLVFSSQRLPTNLFRAF
PRAPAPHPPSMVLSLTTQAAPSSPKGPPLPPPPPLPQPLTLLPPPPAGPFPQNLLETQYQ
DLRGCPIFWMKKDI
Download sequence
Identical sequences ENSCPOP00000018508 XP_013015388.1.53824 10141.ENSCPOP00000018508 ENSCPOP00000018508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]