SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018533 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000018533
Domain Number - Region: 136-205
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00131
Family N-acetyl transferase, NAT 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018533   Gene: ENSCPOG00000025740   Transcript: ENSCPOT00000023220
Sequence length 659
Comment pep:known_by_projection scaffold:cavPor3:scaffold_163:1960974:2010686:-1 gene:ENSCPOG00000025740 transcript:ENSCPOT00000023220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFPVDLLDNCSHEELENSAEDYMSDLRCGDPDNPERFPLPNITIPISLSNVGFVPLYGG
EQTQKILALFAPEDSLTAVALYLADQWWAIDDIVKTSVPAREGLMQVSTLGERVVLYVLN
RIIYRKQEMERNEIPFLCHSSTDYAKILWKKGEAIGFYSVKPTGSMCASFLTQSYQLPVL
DTMFVRKKYRGKDFGLHMLEDFVDSFTEDALGLRYPLSFFLCTACKQYLEKYPGDHELLW
EVEGVGHWYQRIPVTRALQRETLKITAMSHSDAKRPASGEYGLAAVPEYGAGTKDSQSNE
MQIDSLKDAFASTSEGLEKTLASTRARGSHLKRPKIGKRFQDSEFTSSQDEDEKIAQTSP
TASLNKLESTVRTSESSEDFPEEDPEQRGTDFEDDSSDKDARPTPKTQPHPEKQDGEKDS
ELEPMNGEIMDESIKTSLVTEEEDSGNEEELKVQSSNSNENTANSVPLGVESSKHPETVA
PDKTPLIADSEMLIAQGPSDDKAHTEEKLPPVPKKKTYLGNSDSVEERADSGFPNSVIAE
FSEEPISENLSPNTTSSVDDQGEEGPEPRETTTALPQSSLIEVELEDVPFSQNAGQKNQS
EEQSEASSEQLDQFTQSAEKAVDSSSEEIEVEVPVVDRRNLRRKAKGHKGPAKKKAKLT
Download sequence
Identical sequences ENSCPOP00000018533 ENSCPOP00000018533 10141.ENSCPOP00000018533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]