SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018591 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018591
Domain Number 1 Region: 3-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-35
Family Laminin G-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018591
Domain Number - Region: 175-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00587
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018591   Gene: ENSCPOG00000025618   Transcript: ENSCPOT00000024789
Sequence length 208
Comment pep:novel scaffold:cavPor3:scaffold_10:906008:964753:-1 gene:ENSCPOG00000025618 transcript:ENSCPOT00000024789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYWNAASFPNPSSYLHFSTFQGETSADISFYFKTLIPRGVFLENLGNTDFIKLELKSATE
VSFSFDVGNGPVEIVVRSPSPLNDDQWHRVTAERNVKQASLQVDRLPQQIRKAPTEGHTR
LELYSQLFVGGAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFKSGCSGHCTSYGTNCE
NGGKCIEKYHGYSCDCSNTAYDGTFCNK
Download sequence
Identical sequences ENSCPOP00000018591 ENSCPOP00000018591 10141.ENSCPOP00000018591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]