SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018594 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018594
Domain Number 1 Region: 209-394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.34e-39
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 2 Region: 23-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-34
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 3 Region: 602-613,649-717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000301
Family Laminin G-like module 0.055
Further Details:      
 
Domain Number 4 Region: 451-510
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000115
Family Fibrinogen C-terminal domain-like 0.0056
Further Details:      
 
Domain Number 5 Region: 423-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018594   Gene: ENSCPOG00000004241   Transcript: ENSCPOT00000028219
Sequence length 718
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:65284811:65579099:1 gene:ENSCPOG00000004241 transcript:ENSCPOT00000028219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFAGNMNADSVVHHKLLHSVRARFVRFVPLEWNPSGKIGMRVEVYGCSYNSDYLSFEAYR
SAFLTHFYQNQLATSRTMISLKFKSLQGDGVLFHGEGQRGDHITLELQKGRLTLYLNLED
SKARLSSSPPSAILGSLLDDQHWHSVLIERVGKQVNFTVDKHTQHFRAKGEADALDIDYE
LSFGGIPVPGKPGTFLKKNFHGCLENLYYNGVNIIDLAKRRKHQIYTVGNVTFSCSEPQI
VPITFVNSSSSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTKLSEGSGALLLSLEGGIL
RLVIQKMTEHTAEILTGSSLNDGLWHSVSINARRNRITLTLDNEAASPAQDTTSVQIYSG
SNYYFGGCPDNLTDPQCLNPIKAFQGCMRRIFIDNQPKDLISVQQGSLGNFSDLHIDLCS
IKDRCLPNYCEHEGRCSQSWTTFYCNCSDTGYTGATCHNSIYEQSCEVYRHRGNTAGFFY
VDSDGSGPLRPLRVYCNITEDKIWMSVQHNNTELTRVHDASPQKPYTMTLDYGSSLEQLE
ALIDDSEHCEQEVAYHCKRSRLLNTPDGAPFTWWIGRANEKHPYWGGSLPGVQQCECGLE
ESCLDIRHFCNCDADKDEWTNDTGFLSFKDHLPVTQIVITDTNRSNSEAAWRIGPLRCYG
DRHFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFIRLEIS
Download sequence
Identical sequences ENSCPOP00000018594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]