SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018680 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018680
Domain Number 1 Region: 19-139
Classification Level Classification E-value
Superfamily Lysozyme-like 5e-44
Family C-type lysozyme 0.000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018680   Gene: ENSCPOG00000027342   Transcript: ENSCPOT00000026469
Sequence length 141
Comment pep:known scaffold:cavPor3:scaffold_9:50981327:50983368:1 gene:ENSCPOG00000027342 transcript:ENSCPOT00000026469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFFPLLLVGILFPAVQAKQLTKCALSHELNDLAGYRDITLPEWLCIIFHISGYDTQAIV
KNSDHKEYGLFQINDKDFCESSTTVQSRNICDISCDKLLDDDLTDDIMCVKKILDIKGID
YWLAHKPLCSDKLEQWYCEAQ
Download sequence
Identical sequences ENSCPOP00000018680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]