SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018699 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018699
Domain Number 1 Region: 2-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 
Domain Number 2 Region: 313-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000337
Family FAD/NAD-linked reductases, N-terminal and central domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018699   Gene: ENSCPOG00000026225   Transcript: ENSCPOT00000020443
Sequence length 538
Comment pep:novel scaffold:cavPor3:scaffold_39:3869474:3882190:1 gene:ENSCPOG00000026225 transcript:ENSCPOT00000020443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRKIAVIGAGISGLGAIKCCLEEGLEPLCFEKSDDIGGLWRYKETPEDGRAGIYKSLT
SNTSKEMTAFSDYPFPDHYPNYLHNSRMMEYLRMYARHFNLMKHIQFLSKVCSVKKRPDF
LSSGQWDVVVEADGKQKTYVFDGIMICSGHYTDKHLPSQDFKGIQKFRGRYLHSWEYKQP
DDFVGKRVVVIGLGNSGADVAGEISRVAEQVFLSTRQGAWIWSRVWDNGNPTDATLFTRY
NKTVEKFIPTFLLNRLAENKLNSRFNHANYGLYPKHRVFSHQIVFSDDLPKNIITGRVLM
KPNVKEFTATSAIFEDDTEEEIDAIVFATGYAWSFPFLQDESGILDSLNSLFKFVFPPQL
EKPTLAFIGMVQTAGAIMPTSELQSRWVVHIFKGLKRLPSESDMMADLKRRRKKITKRSV
QSARDARRVPYMDYMDEIASELGVKPNLLSFLLSDIKLAKELFYGPCTSYQYRLQGPGKW
SGARKAILTQRDRILRPLSTRVPTPSSYPSSSVFWLKRIFAVIFLSVPMLLIIQMIHH
Download sequence
Identical sequences H0W6U5
10141.ENSCPOP00000018699 XP_003468716.1.53824 ENSCPOP00000018699 ENSCPOP00000018699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]