SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018906 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000018906
Domain Number - Region: 9-33
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0769
Family Snake venom toxins 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018906   Gene: ENSCPOG00000022684   Transcript: ENSCPOT00000019860
Sequence length 52
Comment pep:novel scaffold:cavPor3:scaffold_27:7928030:7928185:1 gene:ENSCPOG00000022684 transcript:ENSCPOT00000019860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELQICTSPCTRLLYLQTALCRKGQKPCYKSCFLRSAPLSKKLASKVLIGPSK
Download sequence
Identical sequences ENSCPOP00000018906 ENSCPOP00000018906 10141.ENSCPOP00000018906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]