SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018955 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018955
Domain Number 1 Region: 445-468
Classification Level Classification E-value
Superfamily Notch domain 0.0000889
Family Notch domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018955
Domain Number - Region: 511-535
Classification Level Classification E-value
Superfamily Notch domain 0.00288
Family Notch domain 0.0039
Further Details:      
 
Domain Number - Region: 938-995
Classification Level Classification E-value
Superfamily EF-hand 0.00884
Family Penta-EF-hand proteins 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018955   Gene: ENSCPOG00000022501   Transcript: ENSCPOT00000020627
Sequence length 1209
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:1096672:1123612:1 gene:ENSCPOG00000022501 transcript:ENSCPOT00000020627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTLVSAFQFGEVVLEWSRDQYHVLFDSYRDNV
AGKSFQSRLCLPVPIDVVYTWVNGTDLELLRELRQVRAQMEEEQKAMREILGKNTTEPTK
RSEQTLECLLTHCIKVPMLVLDPALPANSSLKDLPGLHPAFRTASDLFHVAKPKNPSTNV
SVVVFDNTRDVEDAHASLLKGSGKQTVWRGYLTTDREVPGLVLMQDLAFLSGFPPTFKET
SQLRTKLPEGLAAKIRLLQLYSEASVALLHLHNPRDFQELNKQTKKNMTIQGKELTLSPA
YLLWDLGAISQSKQDEDVSASRFEDNEELRYSLRSVERHAPWVRNIFIVTNGQIPSWLNL
DNPRVKVVTHQEVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCAGSSGGSRYVGG
GGGAGSVAGGQPWQFSGGLSSVSYCSQGCANSWLADKFCDQACNVLACGFDAGDCGQDHF
HELYKVVLRPNQTRYVLPRGERQPYFSFAEIAKRGVEGSYSDSPVIRHASVANKWKTVHL
LLHGGMNATTLQLNLTLQDAAEREFRLQLAIEVDTREGPRPNAKAEVLFEDVPEEKRFPR
VRRLGTPHEPLPMPQVNVSLLPREAQARLRVLDLQLAQGDITVKGYNLSKSALLQAFLTS
VPVTAISPATVTEGRRGHRSLDSSRGLQQPLWPALPAGIAEGHRLHRLLGASPSPVPEAR
AAASPAPGLRRKHPPPAQGERNVAVEKEPQVEAGAADPRDPAAPLPGRRLQQELSGSYLG
FLPWEKTKYFQDLLEEEAALKTQLAYLTDSSHAGRRLQDTFADSLRYVNKILNSKFGFAS
RKVPAHMPHMIDRVVMQELQDMFPEEFDRTSLHKVRHSEDMQFAFSYFYYLMSALQPLNV
AQVFDEVDTDHSGVLSDREIRTLATRVHELPLSLQDLTGLEHMLINCSKMLPANVTQLHA
VPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDRNKYRTTRFEIMGEEEIAFKMIR
TNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPLPSQFELPRE
YRNRFLHVRELREWRAYRDKLKFWTHCVLATLIIFTVFSFFAEQLIALKRKVFPRRRTHK
EASPDRIKV
Download sequence
Identical sequences ENSCPOP00000018955 ENSCPOP00000018955 10141.ENSCPOP00000018955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]