SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018999 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018999
Domain Number 1 Region: 152-300
Classification Level Classification E-value
Superfamily EF-hand 7.08e-53
Family Osteonectin 0.000000101
Further Details:      
 
Domain Number 2 Region: 94-149
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000998
Family Ovomucoid domain III-like 0.0000468
Further Details:      
 
Domain Number 3 Region: 69-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family Follistatin (FS) module N-terminal domain, FS-N 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018999   Gene: ENSCPOG00000025242   Transcript: ENSCPOT00000023141
Sequence length 302
Comment pep:known_by_projection scaffold:cavPor3:scaffold_81:3929887:3940914:-1 gene:ENSCPOG00000025242 transcript:ENSCPOT00000023141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFVLCLAGRAFAAPQQEALPDETEVVEETVAEVSEVPVGTNPVQVEVGEFEEAEE
TVEDVVAENPCQNHHCKHGKVCELDESNTPMCVCQDPTTCAAPAGEFEKVCSNDNKTFDS
SCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYER
DENNNLLTEKQKLKVKKIHENEKRLEAGDHPVELLARDFEKNYKMYIFPVHWQFSQLDQH
PIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDIDKDL
VI
Download sequence
Identical sequences H0W7P5
XP_003464524.1.53824 ENSCPOP00000018999 ENSCPOP00000018999 10141.ENSCPOP00000018999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]