SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019127 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000019127
Domain Number - Region: 235-327
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00459
Family N-acetyl transferase, NAT 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019127   Gene: ENSCPOG00000003787   Transcript: ENSCPOT00000003831
Sequence length 422
Comment pep:known_by_projection scaffold:cavPor3:scaffold_56:9598759:9600027:-1 gene:ENSCPOG00000003787 transcript:ENSCPOT00000003831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRSHWGAWFPSLWVHPACVFGVAFLARVALVFYGVFQDRTLHVRYTDIDYQVFTDAAR
FVTQGRSPYLRATYRYTPLLAWLLTPNVYLSELFGKFLFISCDLLTAFLLYRLLLLKGLE
QRQACGYCVFWLLNPLPMAVSSRGNADSIVASLVLMALYLIEKRLIVCASVFYGFAVHMK
MYPVTYALPITLHLLPERDNEECHQSGHSFQAHLYAFLKRLCSRAVLSFVAVAGLTFFAL
SFGFYHKYGWEFVEHTYLYHLTRRDIRHNFSPYFYMLYLTAESKWSFPLGIAAFLPQFIL
LLAVSFTYYRDLVFCCFLHTYIFVTFNKVCTSQYFLWYLCLLPLVMPLVRMTWQRAVVLL
MLWFIGQALWLAPAYVLEFQGKNTFLFIWLAGLFFLFINCSVLIQIISHYEKKPLTKRTK
YD
Download sequence
Identical sequences H0W821
10141.ENSCPOP00000019127 ENSCPOP00000019127 ENSCPOP00000019127 XP_013004649.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]