SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019132 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019132
Domain Number 1 Region: 32-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000591
Family V set domains (antibody variable domain-like) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019132   Gene: ENSCPOG00000023249   Transcript: ENSCPOT00000020212
Sequence length 227
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:32492305:32493329:-1 gene:ENSCPOG00000023249 transcript:ENSCPOT00000020212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWSVHLPPPLLLLLLFPGSWVRSDEAIFQRVAGDTLTVICNYPAASRESYKEKALCREV
AGFTCGKLVPGASAKGQVPRVSFWDRPKAGHFVVSLARLTEEDSGYYWCSLLEVSSNTVL
NSIKFYVAVSPGEPSRASRAPCTVFRCLSPPPTQAPGAARSPTSSNTQSSTLPTAGTTEA
LRAPSAFTPLAWPQNVTLCPDLADSCALGRGLCGLLLTKSLVLLALL
Download sequence
Identical sequences ENSCPOP00000019132 ENSCPOP00000019132 10141.ENSCPOP00000019132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]