SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019144 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019144
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily Nudix 3.66e-25
Family MutT-like 0.00000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019144   Gene: ENSCPOG00000025043   Transcript: ENSCPOT00000021664
Sequence length 184
Comment pep:novel scaffold:cavPor3:scaffold_1622:70:1869:1 gene:ENSCPOG00000025043 transcript:ENSCPOT00000021664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRMKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEE
PGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSLSIGRKR
QWFKIDDAIRVLQCHKPVHAEYLEKLKLGGSPTDGNSTLESLRPSDGKYFVFTRQTSGIP
STMH
Download sequence
Identical sequences ENSCPOP00000019144 10141.ENSCPOP00000019144 ENSCPOP00000019144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]