SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019147 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019147
Domain Number 1 Region: 418-553
Classification Level Classification E-value
Superfamily TIMP-like 1.73e-30
Family Netrin-like domain (NTR/C345C module) 0.048
Further Details:      
 
Domain Number 2 Region: 371-423
Classification Level Classification E-value
Superfamily BPTI-like 4.11e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 3 Region: 310-366
Classification Level Classification E-value
Superfamily BPTI-like 3.83e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.012
Further Details:      
 
Domain Number 4 Region: 208-289
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000583
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 122-172
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000128
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 36-87
Classification Level Classification E-value
Superfamily Elafin-like 0.000000196
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019147   Gene: ENSCPOG00000021296   Transcript: ENSCPOT00000025793
Sequence length 562
Comment pep:known_by_projection scaffold:cavPor3:scaffold_53:7015965:7020051:-1 gene:ENSCPOG00000021296 transcript:ENSCPOT00000025793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWTMGVLGCHPFWSHCGLRLLLLLLGVLLPGLALPPIRYSHAGICPNDMNPNLWVDAQST
CKRECEADQECETYEKCCPNVCGTRSCVAARYMDVRGRKGPVGMPKEATCDHFMCPQQGS
ECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTW
PNTSPPPPETTVHPTTASPETPGLDLAAPALLNHPAHQSVTVGETVSFLCDVAGRPRPEI
TWEKQLEDRENVVMGPNHVRGNVPQDAGIYTCTARNTAGVLRADFPLSVVRGSPAAAPSE
SSGPNGTAFPAAECLKPPDSEDCGEEQTRWHFDPQTNSCLTFTFGHCHRNLNHFETYEAC
ALACMRGPLAVCSLPALQGPCRAYAPRWAYNSQTGQCQSFVYGGCDGNGNNFQSREACEE
SCPFPRGNQRCPPCKPRQKLVTSFCRSDFVILGRVSELTEEPDMGRALVTVDEVLKDEKM
GLKFLGREPLEVTLLQVDWACPCPNVTVGDTPLIIMGEVEGGMAMLRPDSFVGPSGARRV
RKLREVLHKKTCDVLKEFPGLH
Download sequence
Identical sequences ENSCPOP00000019147 ENSCPOP00000019147 10141.ENSCPOP00000019147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]