SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019226 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019226
Domain Number 1 Region: 72-105
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000455
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019226
Domain Number - Region: 51-157
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.000216
Family Nickel-iron hydrogenase, small subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019226   Gene: ENSCPOG00000026826   Transcript: ENSCPOT00000023949
Sequence length 190
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:27351759:27395648:-1 gene:ENSCPOG00000026826 transcript:ENSCPOT00000023949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELGFGKGGPEQLGSPLHSSYLNSFLQLQRGEALSSSVYKSASPYGSLNNIADGLSSLTEH
FSDLTLSSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYK
CPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCK
VLGYYCRRVQ
Download sequence
Identical sequences ENSCPOP00000019226 10141.ENSCPOP00000019226 ENSCPOP00000019226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]