SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019309 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019309
Domain Number 1 Region: 25-132
Classification Level Classification E-value
Superfamily PWI domain 2.22e-35
Family PWI domain 0.00000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019309   Gene: ENSCPOG00000027193   Transcript: ENSCPOT00000021272
Sequence length 606
Comment pep:novel scaffold:cavPor3:scaffold_6:34016573:34018987:1 gene:ENSCPOG00000027193 transcript:ENSCPOT00000021272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWGFFHGTSPQQDVCFSNKEEKLLKQLKCAECLEKKVDMSKVNLDGIKPWRTKQVTEIL
GFEDDAVIEFIVKQLEVKNPDSKMMQINLSGFLNGNATEFMGEFWSLLLCAQKNITRIPS
AFLELKKEEMKQIEHPYRESSRSPRRCTSTLPSPRRPSPASRERKHCHSPPPHHTTRSLS
PSQTPEPEKNSKTQKEKTRPRSWSRSKSRKGPVSLSSHSTKKASQVKIQIRPSPRRRPSP
SRPQQVPPPPRPRRSPSPGRRRRRSLASLFTSRAPSSTCFSPHSRSPPEPPKRTSRPPPH
THHLNCNSPSCLCYLLQRVPSSPFTTKTSSDSPACRPLPAPSARGCASVSPGSTSITKHK
AAEKEVTRPAPRPAKVGSPDSEKQNSSHMAAVGCGQWRNQNTRGHLTSAASSEDPRPRQP
RGRAARRGGENSPPGGPPSTQAPHLGLPGRRSRRCSPPARAGALRPTREADHRVPAGRRA
APSPPPQPRPALSVSQTKRRSPGSGQPAFCRHLQLPPVCRGGNGRRHPKGGRSLRRASRT
PELKETKKATSPSPRCVRGPPQPAAKRPPAPPSSVQAQGPSTNWPPVAPVREGRSPTPSP
PPAWNS
Download sequence
Identical sequences ENSCPOP00000019309 10141.ENSCPOP00000019309 ENSCPOP00000016917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]