SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019358 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019358
Domain Number 1 Region: 237-277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000157
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019358
Domain Number - Region: 556-596
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.034
Family Spermadhesin, CUB domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019358   Gene: ENSCPOG00000019509   Transcript: ENSCPOT00000021937
Sequence length 822
Comment pep:known_by_projection scaffold:cavPor3:scaffold_7:46327911:46340846:-1 gene:ENSCPOG00000019509 transcript:ENSCPOT00000021937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSHCSCGSDTVASKAMALGLSQLWAGRQAGDVEITVPQGSGVTVLVKRGTLALALRSCYL
IADKRHVDTLSVKPGERRSFAFTCQDPAKHFVLEIKKNIDCASGLCPLGEVPLQPPVSAM
PALNRTFVWDVHARKSTGLELRFSGPRLRQMGPGDYCPDGITHTISGLVAAAVVRIGTFC
GNNGTVSRIKLQEGAKVALHVPWYQNRNMSGFSIANHTAIKRLCIIESVFEGEGAATLMS
ANYPAGFPEDELMTWQFVVPAHLRASVTFLDFNLSNCERKEERVEYYIPGSATNPEVFRL
DDPQPGNMAGNFNLSLQGCDQDAQSPGILRLRFRVLVQIPQNESNKTYVVDLSQDRTLSL
TIQPRSKLSRRFVAGCFVCLESRTCSPNVTLAPGSRYTISFLCDDLTRLWAMAEKTLSCM
DYHYCQRKSFPLQVPSDILRLPVQLRDFSWRLQVPKDRLSLALTPARKLQQHTHERPCNA
SSSYLVASGGPGQDVYFGSFCVGGSIKQLLLRQNSSVTLRTFAPRLQTEVPGLTVSFLPY
FKEEGIFTVTPDTKTKVYLRTPNWDHGLPALSSMSWNISVPSGQEACLTFSKERTGVVCQ
SGRAFMIIQEQRTRAEEIFSLEDDRLPKPSFHRHSFWVNISNCSPASGKQLDLLFWVTVT
PRTLDLTVVIAAVVGGGVSLLFVLGLIICCAKKKKKKVDRGPAVGVYNGNVNTQMPLQPK
KFPKGRQDNDSHVYAVIDDTMVYGHLLQGSSGSFLQPEVDTYRPFQGAMGDRPPSPPPTT
KLAEDEPESEPYTFSHPSQAAGSHGSTLAPLLDTQEPGRPAE
Download sequence
Identical sequences ENSCPOP00000019358 10141.ENSCPOP00000019358 ENSCPOP00000019358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]