SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Cavia porcellus 76_3 > ENSCPOP00000019491

Domain assignment for ENSCPOP00000019491 from Cavia porcellus 76_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCPOP00000019491
Domain Number 1	Region: 90-221
Classification Level	Classification	E-value
Superfamily	YWTD domain	3.4e-16
Family	YWTD domain	0.0019
Further Details:

Domain Number 2	Region: 40-79
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000753
Family	EGF-type module	0.0052
Further Details:

Domain Number 3	Region: 9-50
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000134
Family	EGF-type module	0.029
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCPOP00000019491 Gene: ENSCPOG00000026883 Transcript: ENSCPOT00000026782
Sequence length	223
Comment	pep:novel scaffold:cavPor3:scaffold_3:45927778:45973273:1 gene:ENSCPOG00000026883 transcript:ENSCPOT00000026782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	LIPNCQQMNCQYKCAIVRNSTRCYCEDGFEVKEDGRGCKDQDECAVYGTCSQTCVNTHGS YVCGCVEGYVMQPNNRTCKAKIEPTDSPPMLLTANSETIEIFYLNGSKMATLNSANRNEI HGLDFIYKEETICWVESRDTSNQLKCIQITKTGRLTDEWTINILQSFHNVEQMAIDWLTR NLYFVDHVSDRIFVCNFNGSVCVTLIDLDLHNPKAIAVDPIAG
Download sequence
Identical sequences	ENSCPOP00000019491 10141.ENSCPOP00000019491 ENSCPOP00000019491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]