SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019514 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019514
Domain Number 1 Region: 247-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000444
Family EGF-type module 0.00095
Further Details:      
 
Domain Number 2 Region: 84-210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 275-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 4 Region: 207-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019514   Gene: ENSCPOG00000010252   Transcript: ENSCPOT00000010346
Sequence length 323
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:5123193:5149528:1 gene:ENSCPOG00000010252 transcript:ENSCPOT00000010346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTEGFVCKFSFKGMCRPLALGGPGQVNYSTSVAYSTPFGARGGDFQALPVGSSAAVAVLG
LQLRCAALPGTAEGRWGREAPGAWDCTVEKGGCEHECHWSEGTPRCVCPHQAKLQADGRS
CVAPAGPSCDSLCAHFCVPDPTAPGSYTCMCATGYKLADDQHSCEDVDDCAQVPSVCQQR
CVNTDGGFTCLCDEGFEMVDGECVELMDPCYGSDCEYQCQPLGQDTYKCICAEGFRPKPE
APHLCELFCNETECPADCDPNAPQICYCPEGFILDEGSMCVDIDECDQGHCGSHECHNLL
GTYECVCGPGSPLEGQVSQDCDN
Download sequence
Identical sequences ENSCPOP00000019514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]