SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019906 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019906
Domain Number 1 Region: 343-435
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000143
Family N-acetyl transferase, NAT 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019906   Gene: ENSCPOG00000025966   Transcript: ENSCPOT00000026387
Sequence length 517
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:45894624:46071439:1 gene:ENSCPOG00000025966 transcript:ENSCPOT00000026387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWTSLSPSIVEYFEGEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGK
YVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEIFRRNCEDEPMDSTM
EDTVAGDFALINKLDIKCDLKTLSSDLKESLESEEKKKEKSSKREESHSQAIEEKLGSGE
PSHSIKVHMAPKPGKGADLSKPPCRKAKEIRKERKMLKLMQQNPAGEFEGFQAQGQAPSA
FPPKTKSNHPKSLEDLIFESLPENASHKLEVRLVPVSFEDPEFKSSFSQSFSLYVKYQMA
IHQDPPDECGKTEFTRFLCSSPLEAENPPNGPECGYGSFHQQYWLDGKIIAVGVIDILPY
CVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKGQ
YRPSDLLCPETYVWVPIEQCLPPLENTRYCRFNQDPEAVDQGRSKEPDRVRVFYKKAIMP
YGVYKKYQKDPSEEAAVLQYASLVGQACSERMLLFRS
Download sequence
Identical sequences H0WA95
ENSCPOP00000019906 10141.ENSCPOP00000019906 XP_003479349.1.53824 ENSCPOP00000019906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]