SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019979 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000019979
Domain Number - Region: 478-496,527-558
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00445
Family N-myristoyl transferase, NMT 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019979   Gene: ENSCPOG00000024189   Transcript: ENSCPOT00000026955
Sequence length 600
Comment pep:novel scaffold:cavPor3:scaffold_1:63664792:63685929:1 gene:ENSCPOG00000024189 transcript:ENSCPOT00000026955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMASFTPKKRKQDSLDSDSLEMHLLDIRSKKLILDIAEDLLPSSNKIHTCKSSEINEENV
SCTQQSHFTSSPLRTTNKNRLPLANQSSPFKSAVSTVSFYNKPKWYLNPLERKLVRQSRP
ISLQTSNEGKSVPIVAPKMQGKPVCSKKRNKKLQKSLTTKYQPNHKCIKSVLEMTYKPAM
EKENTCYSTESNLNTPRVLSQKIKPQTTLQSGAAFFISRKKLKRLSLEDKPSVGLNQKDK
SKVIEDCDTKALEQVPKCLLLEKKLNIELSAKSKNEEKLIKDSSIAVVSSKECSLNKTKD
LPSDDSVGENKNPPVSPEPLVYPIFSASSGNTKRSPSEEESSMEPTTYMNFSKQTNTQKT
VNARDANKETKDQLIIDAGQKYFGATMCKSCGMIYSASNPEDEIQHIQYHHRFLEGIKYT
SWKRERVVAEFWDGKILLVLPRDPSYATRKVTDVQELVDYELGFQQVVPRCPEKAKTLLF
VSDDKRVVGFLTAEPIKQAFRVLSEPTGPESSGSKECSRAWQCSNVPEPAVCGISRIWVF
KLKRRKRIARRLVDTLRNCFMFGCFLSTNEIAFSDPTPDGKLFATKYCNTPNFLVYNFNS
Download sequence
Identical sequences ENSCPOP00000019979 10141.ENSCPOP00000019979 ENSCPOP00000019979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]