SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020093 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020093
Domain Number 1 Region: 24-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000086
Family V set domains (antibody variable domain-like) 0.0000403
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000020093
Domain Number - Region: 132-196
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00201
Family C2 set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020093   Gene: ENSCPOG00000020973   Transcript: ENSCPOT00000019797
Sequence length 273
Comment pep:known_by_projection scaffold:cavPor3:scaffold_35:23395746:23403233:1 gene:ENSCPOG00000020973 transcript:ENSCPOT00000019797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMKRSLVQQAQLIVGTAFLKSEAYFNETAELPCQFLNSQNLSLNELVIFWQDQKKLVLY
EFYLGKENLNNVDPKYMQRTSFDQNSWTLRLHRAQIKDKGVYQCIIHHKSPTGLVPHHQK
DTELSLFANFTEPEIVQMSNVTENSGINLTCSSGQGYPKAMKMYFLLKLENSTELEYEGV
MQTSQDNGTELYNVSISSYVPLPDGVSNVTIFCVLKAKQLLLTLIPQGSFEAKSVPRQPS
PIAHQPSWIIAVILIFLILCGMACCLWKRKKKQ
Download sequence
Identical sequences ENSCPOP00000020093 10141.ENSCPOP00000020093 ENSCPOP00000020093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]