SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020126 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020126
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily Histone-fold 2.37e-28
Family Nucleosome core histones 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020126   Gene: ENSCPOG00000026096   Transcript: ENSCPOT00000025358
Sequence length 94
Comment pep:novel scaffold:cavPor3:scaffold_33:20996660:20997342:-1 gene:ENSCPOG00000026096 transcript:ENSCPOT00000025358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHKRMKPRKHPVSRSTRAQLQFPVSRVERYLRENGYLRLSACTPVFLAGILEYLTASAL
HLAARVAHRRHKKRISPEHLARALEKSEQLRQVF
Download sequence
Identical sequences 10141.ENSCPOP00000020126 ENSCPOP00000020126 ENSCPOP00000020126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]