SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020219 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020219
Domain Number 1 Region: 64-367,536-569
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-49
Family FAD-linked reductases, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020219   Gene: ENSCPOG00000022640   Transcript: ENSCPOT00000027175
Sequence length 611
Comment pep:known_by_projection scaffold:cavPor3:scaffold_37:5292988:5303331:1 gene:ENSCPOG00000022640 transcript:ENSCPOT00000027175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLTLVLLAVLLLAGFLKVYLGLFRGRSPNPFSEDVKRPPAPLVTDKEARKKVLKQAFSV
SQVPEKLDAVVIGSGIGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIH
YIGRMKEGSPGRFILDQITEGQLDWALLCPLFDMVVLERPDGRKEFPMYSGRKAYIQGLK
EKFPQEEAVIDKYMQLVQAVSNGASQMIILKFLPLPVVQFLNRCGLLTRFSPFLRASTQS
LAEVLQQLGASAELQAVLSYIFPTYGVTPSHSAFAMHALLVDHYIQGSYYPRGGSSEIAF
HTIPVIERAGGAVLTKATVQSVLLDSAGKACGVSVEKGKELVNIYCPVVISDAGLLNTYQ
HLLPESARCLPAVKQQLGMVRPSMGMMSIFVCLRGTKQDLGLQSTNYYVYFDTDPDKSVR
MQRYTSLPREKAVEHIPLLFITFPSTKDPTWEDRFPDRSTMIVLLPMAFEWFEEWQEEPK
GKRGADYETLKNSFIEACMSVAVKLFPQLEGKVDSVTAGSPLTNQFYLAAPRGTTYGADH
DLSRLHPYTVALMRAQSPIPNLYLTGQDISTCGLLGAVHGALLCSSAILRRNLYSDLKDL
GSRIQAQKKKQ
Download sequence
Identical sequences ENSCPOP00000020219 10141.ENSCPOP00000020219 ENSCPOP00000020219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]