SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020281 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020281
Domain Number 1 Region: 313-719
Classification Level Classification E-value
Superfamily Phosphofructokinase 9.68e-113
Family Phosphofructokinase 0.0000095
Further Details:      
 
Domain Number 2 Region: 1-314
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.31e-97
Family Phosphofructokinase 0.000000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020281   Gene: ENSCPOG00000019438   Transcript: ENSCPOT00000026310
Sequence length 753
Comment pep:known_by_projection scaffold:cavPor3:scaffold_90:907262:920064:1 gene:ENSCPOG00000019438 transcript:ENSCPOT00000026310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKPATWLSVSNIIQLGGTIIGSA
RCQAFTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGGLLEELVREGKISE
TTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEV
MGRHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAI
DRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGIEAVMALLEA
TPDTPACVVSLSGNQSVRLPLMECVQVTKDVQKAMDDRRFEEAIQLRGRSFENNWNIYKL
LAHQKVSKEKTNFSLAILNVGAPAAGMNAAVRSAVRTGISQGHTVYVVHDGFEGLAKGQV
QEVGWHDVAGWLGRGGSMLGTKRTLPKGHMEAIVENLRAHNIHALLVIGGFEAYEGVLQL
VEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVF
IVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLEANVEHMTEKMKTDIQRGLVLRN
EKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWMS
DKLQAVYRKGRVFANAPDSACVIGLRKKVVAFSPVTELKEDTDFEHRMPREQWWLNLRLM
LKMLAHYHISMADYVSGELEHVTRRTLSLDTGF
Download sequence
Identical sequences ENSCPOP00000020281 ENSCPOP00000020281 10141.ENSCPOP00000020281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]